HPA004146

CPB2 antibody from Atlas Antibodies
CPU, PCPB, TAFI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004146
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004146, RRID:AB_1078397
Product name
Anti-CPB2
Provider product page
Atlas Antibodies - HPA004146
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADL
IVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLA
DVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYS
WIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGK
EQAA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -