HPA004146

CPB2 antibody from Sigma-Aldrich
CPU, PCPB, TAFI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004146
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004146, RRID:AB_1078397
Product name
Anti-CPB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004146
Antibody type
Polyclonal
Antigen
Carboxypeptidase B2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADL
IVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLA
DVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYS
WIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGK
EQAA
Storage
-20C
Provider Type Product Number
- No reagents -