HPA004713

SCAP antibody from Sigma-Aldrich
KIAA0199
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004713
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004713, RRID:AB_1079868
Product name
Anti-SCAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004713
Antibody type
Polyclonal
Antigen
Sterol regulatory element-binding protein cleavage-activating protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAAR
LNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPV
YSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVT
GSQDHTLRVFRLED
Storage
-20C
Provider Type Product Number
- No reagents -