HPA004909

PRKAG3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004909
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004909, RRID:AB_1844809
Product name
Anti-PRKAG3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004909
Antibody type
Polyclonal
Antigen
5'-AMP-activated protein kinase subunit gamma-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKAL
RWTRQKSVEEGEPPGQGEGPRSRPAAESTGLEATF
PKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGS
STDDVELA
Storage
-20C
Provider Type Product Number
- No reagents -