HPA004170

CAPN10 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004170
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004170, RRID:AB_1078381
Product name
Anti-CAPN10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004170
Antibody type
Polyclonal
Antigen
Calpain-10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGG
LAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLK
DQCLISCCVLSPRAGARELGEFHAFIVSDL
Storage
-20C
Provider Type Product Number
- No reagents -