Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000685-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000685-D01P, RRID:AB_1673052
- Product name
- BTC purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human BTC protein.
- Antigen sequence
MDRAARCSGASSLPLLLALALGLVILHCVVADGNS
TRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCP
KQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCE
RVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCT
CCHPLRKRRKRKKKEEEMETLGKDITPINEDIEET
NIA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BTC expression in transfected 293T cell line (H00000685-T01) by BTC MaxPab polyclonal antibody.Lane 1: BTC transfected lysate(19.70 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between BTC and ERBB2. HeLa cells were stained with anti-BTC rabbit purified polyclonal 1:1200 and anti-ERBB2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)