Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018105 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-NPC1L1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
CSDNFVNLHCHNTCSPNQSLFINVTRVAQLGAGQL
PAVVAYEAFYQHSFAEQSYDSCSRVRVPAAATLAV
GTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITF
HLLEPGQAVGSGIQPLNEGVARCNESQGDDVATCS
CQDCAAS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Ezetimibe Promotes Brush Border Membrane-to-Lumen Cholesterol Efflux in the Small Intestine
Fomiroid A, a Novel Compound from the Mushroom Fomitopsis nigra, Inhibits NPC1L1-Mediated Cholesterol Uptake via a Mode of Action Distinct from That of Ezetimibe
Yu L, Nakano T, Inoue I, Takenaka Y, Ono H, Katayama S, Awata T, Murakoshi T
PLOS ONE 2016;11(3):e0152207
PLOS ONE 2016;11(3):e0152207
Fomiroid A, a Novel Compound from the Mushroom Fomitopsis nigra, Inhibits NPC1L1-Mediated Cholesterol Uptake via a Mode of Action Distinct from That of Ezetimibe
Makishima M, Chiba T, Sakurada T, Watanabe R, Yamaguchi K, Kimura Y, Kioka N, Kawagishi H, Matsuo M, Ueda K
PLoS ONE 2014;9(12):e116162
PLoS ONE 2014;9(12):e116162
No comments: Submit comment
No validations: Submit validation data