HPA023545

PPEF2 antibody from Sigma-Aldrich
PPP7CB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023545
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023545, RRID:AB_1855613
Product name
Anti-PPEF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023545
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase with EF-hands 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKV
LILHGGVSDITDLELLDKIERSKIVSTMRCKTRQK
SEKQMEEKRRANQKSSAQGPIPWFLPESRSLPSSP
LRLGSYKAQKTSRSS
Storage
-20C
Provider Type Product Number
- No reagents -