H00011180-M01

WDR6 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00011180-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011180-M01, RRID:AB_437104
Product name
WDR6 monoclonal antibody (M01), clone 2D4
Provider product page
Abnova Corporation - H00011180-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant WDR6.
Antigen sequence
MHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAV
CELDQPGLGPLVAAACSDGAVRLFLLQDSGRILQL
LAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAAT
DGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTP
SLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSL
HVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPC
AHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGE
PTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQ
GLEVYNWYD
Isotype
IgG
Antibody clone number
2D4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -