Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182688 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box N3 (FOXN3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHES1 antibody: synthetic peptide directed towards the C terminal of human CHES1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPP
ESDDE EMKEAAGSLL- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CHES1/FOXN3 regulates cell proliferation by repressing PIM2 and protein biosynthesis.
Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
Huot G, Vernier M, Bourdeau V, Doucet L, Saint-Germain E, Gaumont-Leclerc MF, Moro A, Ferbeyre G
Molecular biology of the cell 2014 Mar;25(5):554-65
Molecular biology of the cell 2014 Mar;25(5):554-65
Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
Yu Y, Zhang C, Zhou G, Wu S, Qu X, Wei H, Xing G, Dong C, Zhai Y, Wan J, Ouyang S, Li L, Zhang S, Zhou K, Zhang Y, Wu C, He F
Genome research 2001 Aug;11(8):1392-403
Genome research 2001 Aug;11(8):1392-403
No comments: Submit comment
No validations: Submit validation data