Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107269 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Forkhead Box N3 (FOXN3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHES1 antibody: synthetic peptide directed towards the C terminal of human CHES1
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SGYASQHKKRQHFAKARKVPSDTLPLKKRRTEKPP
ESDDEEMKEAAGSLL- Epitope
- C-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
Yu Y, Zhang C, Zhou G, Wu S, Qu X, Wei H, Xing G, Dong C, Zhai Y, Wan J, Ouyang S, Li L, Zhang S, Zhou K, Zhang Y, Wu C, He F
Genome research 2001 Aug;11(8):1392-403
Genome research 2001 Aug;11(8):1392-403
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; WB Suggested Anti-CHES1 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate. FOXN3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.; CHES1 antibody - C-terminal region (AP42148PU-N) in Human HepG2 cells using Western Blot