HPA004796

TNFRSF1B antibody from Atlas Antibodies
CD120b, p75, TNF-R-II, TNF-R75, TNFBR, TNFR2, TNFR80
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004796
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004796, RRID:AB_1078436
Product name
Anti-TNFRSF1B
Provider product page
Atlas Antibodies - HPA004796
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSC
GSRCSSDQVETQACTREQNRICTCRPGWYCALSKQ
EGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAP
GTFSNTTSSTDICRPHQICNVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -