HPA004796
antibody from Atlas Antibodies
Targeting: TNFRSF1B
CD120b, p75, TNF-R-II, TNF-R75, TNFBR, TNFR2, TNFR80
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004796 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004796, RRID:AB_1078436
- Product name
- Anti-TNFRSF1B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSC
GSRCSSDQVETQACTREQNRICTCRPGWYCALSKQ
EGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAP
GTFSNTTSSTDICRPHQICNVV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Selective Inhibition of Soluble Tumor Necrosis Factor Alters the Neuroinflammatory Response following Moderate Spinal Cord Injury in Mice
Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Lund M, Ellman D, Nielsen P, Raffaele S, Fumagalli M, Guzman R, Degn M, Brambilla R, Meyer M, Clausen B, Lambertsen K
Biology 2023;12(6):845
Biology 2023;12(6):845
Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Kim K, Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P
PLoS Pathogens 2014;10(4):e1004038
PLoS Pathogens 2014;10(4):e1004038
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Kato B, Nicholson G, Neiman M, Rantalainen M, Holmes C, Barrett A, Uhlén M, Nilsson P, Spector T, Schwenk J
Proteome Science 2011;9(1):73
Proteome Science 2011;9(1):73
No comments: Submit comment
No validations: Submit validation data