HPA004796

TNFRSF1B antibody from Sigma-Aldrich
CD120b, p75, TNF-R-II, TNF-R75, TNFBR, TNFR2, TNFR80
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004796
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004796, RRID:AB_1078436
Product name
Anti-TNFRSF1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004796
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 1B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSC
GSRCSSDQVETQACTREQNRICTCRPGWYCALSKQ
EGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAP
GTFSNTTSSTDICRPHQICNVV
Storage
-20C
Provider Type Product Number
- No reagents -