HPA004812

CDH1 antibody from Sigma-Aldrich
CD324, UVO, uvomorulin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004812, RRID:AB_1078369
Product name
Anti-CDH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004812
Antibody type
Polyclonal
Antigen
Epithelial-cadherin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIF
FCERNPKPQVINIIDADLPPNTSPFTAELTHGASA
NWTIQYNDPTQESIILKPKMALEVGDYKINLKLMD
NQNKDQVTTLEVSVCDCEGA
Storage
-20C
Provider Type Product Number
- No reagents -