HPA020273

CCM2 antibody from Sigma-Aldrich
C7orf22, MGC4607, OSM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020273
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020273, RRID:AB_1846185
Product name
Anti-CCM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020273
Antibody type
Polyclonal
Antigen
Malcavernin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS
PHSKTISESELSASATELLQDYMLTLRTKLSSQEI
QQFAALLHEYRNGA
Storage
-20C
Provider Type Product Number
- No reagents -