HPA023314

SHMT1 antibody from Atlas Antibodies
CSHMT, MGC15229, MGC24556, SHMT

Antibody data

Product number
HPA023314
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023314, RRID:AB_1856830
Product name
Anti-SHMT1
Provider product page
Atlas Antibodies - HPA023314
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYN
IIKKESNRQRVGLELIASENFASRAVLEALGSCL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.