Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006470-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006470-M01, RRID:AB_509233
- Product name
- SHMT1 monoclonal antibody (M01), clone 4F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SHMT1.
- Antigen sequence
EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPAL
TSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRA
TLKEFKERLAGDKYQAAVQALREEVESFASLFPLP
GLPD- Isotype
- IgG
- Antibody clone number
- 4F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mass spectrometric/bioinformatic identification of a protein subset that characterizes the cellular activity of anticancer peptides.
Genovese F, Gualandi A, Taddia L, Marverti G, Pirondi S, Marraccini C, Perco P, PelĂ M, Guerrini R, Amoroso MR, Esposito F, Martello A, Ponterini G, D'Arca D, Costi MP
Journal of proteome research 2014 Nov 7;13(11):5250-61
Journal of proteome research 2014 Nov 7;13(11):5250-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SHMT1 monoclonal antibody (M01), clone 4F9 Western Blot analysis of SHMT1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SHMT1 expression in transfected 293T cell line by SHMT1 monoclonal antibody (M01), clone 4F9.Lane 1: SHMT1 transfected lysate(53.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SHMT1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol