HPA023314

SHMT1 antibody from Sigma-Aldrich
CSHMT, MGC15229, MGC24556, SHMT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023314
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023314, RRID:AB_1856830
Product name
Anti-SHMT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023314
Antibody type
Polyclonal
Antigen
Serine hydroxymethyltransferase, cytosolic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYN
IIKKESNRQRVGLELIASENFASRAVLEALGSCL
Storage
-20C
Provider Type Product Number
- No reagents -