Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183131 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQAN
TLVDL AKTQNIMYDM- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer's disease mice.
Calcium-dependent regulation of secretion in biliary epithelial cells: the role of apamin-sensitive SK channels.
Chakroborty S, Kim J, Schneider C, Jacobson C, Molgó J, Stutzmann GE
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Jun 13;32(24):8341-53
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Jun 13;32(24):8341-53
Calcium-dependent regulation of secretion in biliary epithelial cells: the role of apamin-sensitive SK channels.
Feranchak AP, Doctor RB, Troetsch M, Brookman K, Johnson SM, Fitz JG
Gastroenterology 2004 Sep;127(3):903-13
Gastroenterology 2004 Sep;127(3):903-13
No comments: Submit comment
No validations: Submit validation data