H00022859-M03

ADGRL1 antibody from Abnova Corporation
CIRL1, KIAA0821, LEC2, LPHN1
No application information provided.

Antibody data

Product number
H00022859-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022859-M03, RRID:AB_1136954
Product name
LPHN1 monoclonal antibody (M03), clone 4E12
Provider product page
Abnova Corporation - H00022859-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LPHN1.
Antigen sequence
MGLASHLERLMAEGKWGGTGVVEGMGMAEEGAGNG
KAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSG
HPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLS
GQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLH
LCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFV
GLRGRGSRKELGGRGQVGGWRDPFCC
Isotype
IgG
Antibody clone number
4E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -