HPA048560

antibody from Atlas Antibodies

Targeting: HDAC8 HDACL1, KDAC8, MRXS6, RPD3, WTS

Antibody data

Submit

Validation data

Product number: HPA048560 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048560, RRID:AB_2680442
Product name: Anti-HDAC8
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTP VGIGKCLKYILQWQLATLILGGGGYNLANTARCWT YLTGVILGKTLSSEIPDHEF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HDAC8 protein structure - HPA048560 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using HPA048560 antibody. Corresponding HDAC8 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach, upper shows moderate nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows moderate to strong nuclear positivity in glandular cells, as well as in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes.
Sample type: HUMAN