Antibody data

Product number
H00003127-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003127-B02, RRID:AB_1204479
Product name
HLA-DRB5 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00003127-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HLA-DRB5 protein.
Antigen sequence
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPR
FLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFD
SDVGEYRAVTELGRPDAEYWNSQKDFLEDRRAAVD
TYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQH
HNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTG
LIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT
SPLTVEWRAQSESAQSKMLSGVGGFVLGLLFLGAG
LFIYFKNQKGHSGLHPTGLVS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -