HPA004190

PARK7 antibody from Sigma-Aldrich
DJ-1, DJ1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004190
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004190, RRID:AB_1079566
Product name
Anti-PARK7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004190
Antibody type
Polyclonal
Antigen
Protein DJ-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPG
GNLGAQNLSESAAVKEILKEQENRKGLIAAICAGP
TALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSEN
RVEKDGLILTSRGPGTSFEFALAIVEALNGKEV
Storage
-20C
Provider Type Product Number
- No reagents -