HPA004832

ARPC1B antibody from Sigma-Aldrich
ARC41, p40-ARC, p41-ARC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004832, RRID:AB_1845044
Product name
Anti-ARPC1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004832
Antibody type
Polyclonal
Antigen
Actin-related protein 2/3 complex subunit 1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVCLADADKKMAVATLASETLPLLALTFITDNSLV
AAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQR
GLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSV
SQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLES
A
Storage
-20C
Provider Type Product Number
- No reagents -