HPA006558

CA1 antibody from Sigma-Aldrich
Car1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006558
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006558, RRID:AB_1845989
Product name
Anti-CA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006558
Antibody type
Polyclonal
Antigen
Carbonic anhydrase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK
PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLK
GGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYS
AELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
Storage
-20C
Provider Type Product Number
- No reagents -