HPA005448

RAD17 antibody from MilliporeSigma / Merck KGaA
CCYC, RAD17Sp, Rad24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005448
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005448, RRID:AB_1079738
Product name
Anti-RAD17 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005448
Antibody type
Polyclonal
Antigen
Cell cycle checkpoint protein RAD17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFH
MFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDK
KIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLI
FIISDSLSGDNNQRLLFPKEIQEECSISNISFNPV
AP
Storage
-20C
Provider Type Product Number
- No reagents -