Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501275 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zyxin (ZYX) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZYX antibody: synthetic peptide directed towards the middle region of human ZYX
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAP
GGSGS QPNQKLGHPE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo.
Martynova NY, Eroshkin FM, Ermolina LV, Ermakova GV, Korotaeva AL, Smurova KM, Gyoeva FK, Zaraisky AG
Developmental dynamics : an official publication of the American Association of Anatomists 2008 Mar;237(3):736-49
Developmental dynamics : an official publication of the American Association of Anatomists 2008 Mar;237(3):736-49
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting