Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009146-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009146-M01, RRID:AB_490068
- Product name
- HGS monoclonal antibody (M01), clone 6D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HGS.
- Antigen sequence
KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRL
EQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQ
PSGPASFPSTFSPAGSVEGSPMHGVYMSQP- Isotype
- IgG
- Antibody clone number
- 6D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The class III kinase Vps34 promotes T lymphocyte survival through regulating IL-7Rα surface expression.
McLeod IX, Zhou X, Li QJ, Wang F, He YW
Journal of immunology (Baltimore, Md. : 1950) 2011 Nov 15;187(10):5051-61
Journal of immunology (Baltimore, Md. : 1950) 2011 Nov 15;187(10):5051-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HGS monoclonal antibody (M01), clone 6D11 Western Blot analysis of HGS expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.Lane 1: HGS transfected lysate(86.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HGS on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol