Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91385 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91385, RRID:AB_2716665
- Product name
- Anti-GRN
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCP
AGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQ
ALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPE
AVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL- Epitope
- Binds to an epitope located within the peptide sequence DHQHCCPQGYTCVAE as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL5695
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line PC-3.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate granular cytoplasmic immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows cytoplasmic immunoreactivity in Kupffer cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate granular cytoplasmic immunoreactivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows absence of positivity in striated muscle fibers as expected (negative control).