HPA008763

GRN antibody from Atlas Antibodies
CLN11, PCDGF, PGRN
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008763
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008763, RRID:AB_1850339
Product name
Anti-GRN
Provider product page
Atlas Antibodies - HPA008763
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRV
HCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTN
RAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCC
PMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENAT
TDLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -