HPA008763

GRN antibody from Sigma-Aldrich
CLN11, PCDGF, PGRN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008763
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008763, RRID:AB_1850339
Product name
Anti-GRN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008763
Antibody type
Polyclonal
Antigen
Granulins precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRV
HCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTN
RAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCC
PMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENAT
TDLL
Storage
-20C
Provider Type Product Number
- No reagents -