Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406615 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRKRIR antibody: synthetic peptide directed towards the N terminal of human PRKRIR
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICR
TSPYR TVLRDNAIPT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A gene expression in study human gastric adenocarcinoma using a cDNA microarray.
Lee JH, Choi SR, Hwang TH, Kim MC, Jung GJ, Roh MS, Jeong JS
The Korean journal of gastroenterology = Taehan Sohwagi Hakhoe chi 2003 Dec;42(6):484-95
The Korean journal of gastroenterology = Taehan Sohwagi Hakhoe chi 2003 Dec;42(6):484-95
No comments: Submit comment
No validations: Submit validation data