HPA008736

DAXX antibody from Sigma-Aldrich
DAP6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008736, RRID:AB_1078625
Product name
Anti-DAXX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008736
Antibody type
Polyclonal
Antigen
Death domain-associated protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQIS
RSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGE
QPEELTLEEESPVSQLFELEIEALPLDTPSSVETD
ISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPH
NWGDSG
Storage
-20C
Provider Type Product Number
- No reagents -