Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309650 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Bone Morphogenetic Protein 7 (BMP7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPY
KAVFS TQGPPLASLQ- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Putative prognostic epithelial-to-mesenchymal transition biomarkers for aggressive prostate cancer.
Effects of demineralized bone matrix on tendon-bone healing in an intra-articular rodent model.
Expression of chondro-osteogenic BMPs in clinical samples of patellar tendinopathy.
Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma.
Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats.
Combination of small molecules enhances differentiation of mouse embryonic stem cells into intermediate mesoderm through BMP7-positive cells.
Regulation of embryonic kidney branching morphogenesis and glomerular development by KISS1 receptor (Gpr54) through NFAT2- and Sp1-mediated Bmp7 expression.
Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment.
The prodomain of BMP-7 targets the BMP-7 complex to the extracellular matrix.
Whiteland H, Spencer-Harty S, Thomas DH, Davies C, Morgan C, Kynaston H, Bose P, Fenn N, Lewis PD, Bodger O, Jenkins S, Doak SH
Experimental and molecular pathology 2013 Oct;95(2):220-6
Experimental and molecular pathology 2013 Oct;95(2):220-6
Effects of demineralized bone matrix on tendon-bone healing in an intra-articular rodent model.
Lovric V, Chen D, Yu Y, Oliver RA, Genin F, Walsh WR
The American journal of sports medicine 2012 Oct;40(10):2365-74
The American journal of sports medicine 2012 Oct;40(10):2365-74
Expression of chondro-osteogenic BMPs in clinical samples of patellar tendinopathy.
Rui YF, Lui PP, Rolf CG, Wong YM, Lee YW, Chan KM
Knee surgery, sports traumatology, arthroscopy : official journal of the ESSKA 2012 Jul;20(7):1409-17
Knee surgery, sports traumatology, arthroscopy : official journal of the ESSKA 2012 Jul;20(7):1409-17
Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma.
Fiaschetti G, Castelletti D, Zoller S, Schramm A, Schroeder C, Nagaishi M, Stearns D, Mittelbronn M, Eggert A, Westermann F, Ohgaki H, Shalaby T, Pruschy M, Arcaro A, Grotzer MA
Oncogene 2011 Jun 23;30(25):2823-35
Oncogene 2011 Jun 23;30(25):2823-35
Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats.
Filion TM, Li X, Mason-Savas A, Kreider JM, Goldstein SA, Ayers DC, Song J
Tissue engineering. Part A 2011 Feb;17(3-4):503-11
Tissue engineering. Part A 2011 Feb;17(3-4):503-11
Combination of small molecules enhances differentiation of mouse embryonic stem cells into intermediate mesoderm through BMP7-positive cells.
Mae S, Shirasawa S, Yoshie S, Sato F, Kanoh Y, Ichikawa H, Yokoyama T, Yue F, Tomotsune D, Sasaki K
Biochemical and biophysical research communications 2010 Mar 19;393(4):877-82
Biochemical and biophysical research communications 2010 Mar 19;393(4):877-82
Regulation of embryonic kidney branching morphogenesis and glomerular development by KISS1 receptor (Gpr54) through NFAT2- and Sp1-mediated Bmp7 expression.
Yi T, Tan K, Cho SG, Wang Y, Luo J, Zhang W, Li D, Liu M
The Journal of biological chemistry 2010 Jun 4;285(23):17811-20
The Journal of biological chemistry 2010 Jun 4;285(23):17811-20
Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment.
Morrissey C, Brown LG, Pitts TE, Vessella RL, Corey E
Neoplasia (New York, N.Y.) 2010 Feb;12(2):192-205
Neoplasia (New York, N.Y.) 2010 Feb;12(2):192-205
The prodomain of BMP-7 targets the BMP-7 complex to the extracellular matrix.
Gregory KE, Ono RN, Charbonneau NL, Kuo CL, Keene DR, Bächinger HP, Sakai LY
The Journal of biological chemistry 2005 Jul 29;280(30):27970-80
The Journal of biological chemistry 2005 Jul 29;280(30):27970-80
No comments: Submit comment
No validations: Submit validation data