Antibody data
- Antibody Data
 - Antigen structure
 - References [16]
 - Comments [0]
 - Validations
 - Western blot [2]
 - ELISA [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00057447-M03 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00057447-M03, RRID:AB_534954
 - Product name
 - NDRG2 monoclonal antibody (M03), clone 6A5
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant NDRG2.
 - Antigen sequence
 MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGS
VTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQ
FEDMQEIIQNFVRVHVDAPGMEEGAP- Isotype
 - IgG
 - Antibody clone number
 - 6A5
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		N-myc downstream-regulated gene 2 expression is associated with glucose transport and correlated with prognosis in breast carcinoma.
				
Tumor suppressor NDRG2 tips the balance of oncogenic TGF-β via EMT inhibition in colorectal cancer.
				
NDRG2 is a novel p53-associated regulator of apoptosis in C6-originated astrocytes exposed to oxygen-glucose deprivation.
				
NDRG2: a newly identified mediator of insulin cardioprotection against myocardial ischemia-reperfusion injury.
				
Regulation of N-Myc downstream regulated gene 2 by bile acids.
				
NDRG2 down-regulation and CD24 up-regulation promote tumor aggravation and poor survival in patients with gallbladder carcinoma.
				
NDRG2 correlated with favorable recurrence-free survival inhibits metastasis of mouse breast cancer cells via attenuation of active TGF-β production.
				
Microarray profiling of HepG2 cells ectopically expressing NDRG2.
				
Up-regulation of NDRG2 through nuclear factor-kappa B is required for Leydig cell apoptosis in both human and murine infertile testes.
				
Regulation of histone acetylation by NDRG2 in glioma cells.
				
NDRG2 ameliorates hepatic fibrosis by inhibiting the TGF-β1/Smad pathway and altering the MMP2/TIMP2 ratio in rats.
				
Spatial-temporal expression of NDRG2 in rat brain after focal cerebral ischemia and reperfusion.
				
NDRG2 inhibits hepatocellular carcinoma adhesion, migration and invasion by regulating CD24 expression.
				
Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury.
				
NDRG2 is highly expressed in pancreatic beta cells and involved in protection against lipotoxicity.
				
Immunohistochemical detection of Ndrg2 in the mouse nervous system.
				
		
	
			Ma J, Liu W, Guo H, Li S, Cao W, Du X, Lei S, Hou W, Xiong L, Yao L, Li N, Li Y
Breast cancer research : BCR 2014 Mar 18;16(2):R27
		Breast cancer research : BCR 2014 Mar 18;16(2):R27
Tumor suppressor NDRG2 tips the balance of oncogenic TGF-β via EMT inhibition in colorectal cancer.
			Shen L, Qu X, Ma Y, Zheng J, Chu D, Liu B, Li X, Wang M, Xu C, Liu N, Yao L, Zhang J
Oncogenesis 2014 Feb 3;3(2):e86
		Oncogenesis 2014 Feb 3;3(2):e86
NDRG2 is a novel p53-associated regulator of apoptosis in C6-originated astrocytes exposed to oxygen-glucose deprivation.
			Li Y, Xu N, Cai L, Gao Z, Shen L, Zhang Q, Hou W, Zhong H, Wang Q, Xiong L
PloS one 2013;8(2):e57130
		PloS one 2013;8(2):e57130
NDRG2: a newly identified mediator of insulin cardioprotection against myocardial ischemia-reperfusion injury.
			Sun Z, Tong G, Ma N, Li J, Li X, Li S, Zhou J, Xiong L, Cao F, Yao L, Wang H, Shen L
Basic research in cardiology 2013 May;108(3):341
		Basic research in cardiology 2013 May;108(3):341
Regulation of N-Myc downstream regulated gene 2 by bile acids.
			Langhi C, Pedraz-Cuesta E, Donate Y, Marrero PF, Haro D, Rodríguez JC
Biochemical and biophysical research communications 2013 Apr 26;434(1):102-9
		Biochemical and biophysical research communications 2013 Apr 26;434(1):102-9
NDRG2 down-regulation and CD24 up-regulation promote tumor aggravation and poor survival in patients with gallbladder carcinoma.
			Song SP, Zhang SB, Liu R, Yao L, Hao YQ, Liao MM, Zhang YD, Li ZH
Medical oncology (Northwood, London, England) 2012 Sep;29(3):1879-85
		Medical oncology (Northwood, London, England) 2012 Sep;29(3):1879-85
NDRG2 correlated with favorable recurrence-free survival inhibits metastasis of mouse breast cancer cells via attenuation of active TGF-β production.
			Oh SS, Kim D, Kim DH, Chang HH, Sohn KC, Kim KH, Jung SH, Lee BK, Kim JH, Kim KD
Carcinogenesis 2012 Oct;33(10):1882-8
		Carcinogenesis 2012 Oct;33(10):1882-8
Microarray profiling of HepG2 cells ectopically expressing NDRG2.
			Liu X, Niu T, Liu X, Hou W, Zhang J, Yao L
Gene 2012 Jul 15;503(1):48-55
		Gene 2012 Jul 15;503(1):48-55
Up-regulation of NDRG2 through nuclear factor-kappa B is required for Leydig cell apoptosis in both human and murine infertile testes.
			Li T, Hu J, He GH, Li Y, Zhu CC, Hou WG, Zhang S, Li W, Zhang JS, Wang Z, Liu XP, Yao LB, Zhang YQ
Biochimica et biophysica acta 2012 Feb;1822(2):301-13
		Biochimica et biophysica acta 2012 Feb;1822(2):301-13
Regulation of histone acetylation by NDRG2 in glioma cells.
			Li L, Qin X, Shi M, Miao R, Wang L, Liu X, Yao L, Deng Y
Journal of neuro-oncology 2012 Feb;106(3):485-92
		Journal of neuro-oncology 2012 Feb;106(3):485-92
NDRG2 ameliorates hepatic fibrosis by inhibiting the TGF-β1/Smad pathway and altering the MMP2/TIMP2 ratio in rats.
			Yang J, Zheng J, Wu L, Shi M, Zhang H, Wang X, Xia N, Wang D, Liu X, Yao L, Li Y, Dou K
PloS one 2011;6(11):e27710
		PloS one 2011;6(11):e27710
Spatial-temporal expression of NDRG2 in rat brain after focal cerebral ischemia and reperfusion.
			Li Y, Shen L, Cai L, Wang Q, Hou W, Wang F, Zeng Y, Zhao G, Yao L, Xiong L
Brain research 2011 Mar 25;1382:252-8
		Brain research 2011 Mar 25;1382:252-8
NDRG2 inhibits hepatocellular carcinoma adhesion, migration and invasion by regulating CD24 expression.
			Zheng J, Li Y, Yang J, Liu Q, Shi M, Zhang R, Shi H, Ren Q, Ma J, Guo H, Tao Y, Xue Y, Jiang N, Yao L, Liu W
BMC cancer 2011 Jun 16;11:251:1-9
		BMC cancer 2011 Jun 16;11:251:1-9
Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury.
			Sun Z, Shen L, Sun X, Tong G, Sun D, Han T, Yang G, Zhang J, Cao F, Yao L, Wang H
Histochemistry and cell biology 2011 Jan;135(1):27-35
		Histochemistry and cell biology 2011 Jan;135(1):27-35
NDRG2 is highly expressed in pancreatic beta cells and involved in protection against lipotoxicity.
			Shen L, Liu X, Hou W, Yang G, Wu Y, Zhang R, Li X, Che H, Lu Z, Zhang Y, Liu X, Yao L
Cellular and molecular life sciences : CMLS 2010 Apr;67(8):1371-81
		Cellular and molecular life sciences : CMLS 2010 Apr;67(8):1371-81
Immunohistochemical detection of Ndrg2 in the mouse nervous system.
			Shen L, Zhao ZY, Wang YZ, Ji SP, Liu XP, Liu XW, Che HL, Lin W, Li X, Zhang J, Yao LB
Neuroreport 2008 Jun 11;19(9):927-31
		Neuroreport 2008 Jun 11;19(9):927-31
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of NDRG2 expression in transfected 293T cell line by NDRG2 monoclonal antibody (M03), clone 6A5.Lane 1: NDRG2 transfected lysate(39.7 KDa).Lane 2: Non-transfected lysate.
 
- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - NDRG2 monoclonal antibody (M03), clone 6A5. Western Blot analysis of NDRG2 expression in Hela S3 NE.
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged NDRG2 is approximately 0.03ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol