Antibody data

Product number
H00057447-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057447-M10, RRID:AB_1679415
Product name
NDRG2 monoclonal antibody (M10), clone 1D6
Provider product page
Abnova Corporation - H00057447-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant NDRG2.
Antigen sequence
MAELQEVQITEEKPLLPGQTPEAAKEAELAARILL
DQGQTHSVETPYVSVTFTVYGTPKPKRPAILTYHD
VGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGM
EEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTI
IGVGVGAGAYILARYALNHPDTVEGLVLINIDPNA
KGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGN
SELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNF
ERGGDITLRCPVMLVVECNSKLDPTQTSFLKMADS
GGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLS
RSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSG
PPGHTMEVSC
Isotype
IgG
Antibody clone number
1D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -