HPA002896

NDRG2 antibody from Atlas Antibodies
KIAA1248, SYLD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002896
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002896, RRID:AB_1079459
Product name
Anti-NDRG2
Provider product page
Atlas Antibodies - HPA002896
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNII
THAPNLDNIELYWNSYNNRRDLNFERGGDITLRCP
VMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADS
GGQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -