Antibody data

Product number
H00004172-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004172-M06, RRID:AB_1136957
Product name
MCM3 monoclonal antibody (M06), clone 3E11
Provider product page
Abnova Corporation - H00004172-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MCM3.
Antigen sequence
EEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQY
EEFYVGLEGSFGSKHVS
Isotype
IgG
Antibody clone number
3E11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -