Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004789 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004789, RRID:AB_1079336
- Product name
- Anti-MCM3
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYS
RLRSQDSMSSDTARTSPVTARTLETLIRLATAHAK
ARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRK
KRSEDESETEDEEEKSQEDQEQKRKRRKTR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references High MCM3 expression is an independent biomarker of poor prognosis and correlates with reduced RBM3 expression in a prospective cohort of malignant melanoma.
RBM3-regulated genes promote DNA integrity and affect clinical outcome in epithelial ovarian cancer.
Nodin B, Fridberg M, Jonsson L, Bergman J, Uhlén M, Jirström K
Diagnostic pathology 2012 Jul 17;7:82
Diagnostic pathology 2012 Jul 17;7:82
RBM3-regulated genes promote DNA integrity and affect clinical outcome in epithelial ovarian cancer.
Ehlén Å, Nodin B, Rexhepaj E, Brändstedt J, Uhlén M, Alvarado-Kristensson M, Pontén F, Brennan DJ, Jirström K
Translational oncology 2011 Aug;4(4):212-21
Translational oncology 2011 Aug;4(4):212-21
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong nuclear positivity in reaction center cells.
- Sample type
- HUMAN