HPA004789

MCM3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004789
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004789, RRID:AB_1079336
Product name
Anti-MCM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004789
Antibody type
Polyclonal
Antigen
DNA replication licensing factor MCM3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYS
RLRSQDSMSSDTARTSPVTARTLETLIRLATAHAK
ARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRK
KRSEDESETEDEEEKSQEDQEQKRKRRKTR
Storage
-20C
Provider Type Product Number
- No reagents -