HPA004845

COPS5 antibody from Atlas Antibodies
CSN5, JAB1, MOV-34, SGN5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004845
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004845, RRID:AB_1078557
Product name
Anti-COPS5
Provider product page
Atlas Antibodies - HPA004845
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHH
YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKV
DGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -