HPA004845

COPS5 antibody from Sigma-Aldrich
CSN5, JAB1, MOV-34, SGN5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004845, RRID:AB_1078557
Product name
Anti-COPS5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004845
Antibody type
Polyclonal
Antigen
COP9 signalosome complex subunit 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHH
YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKV
DGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLS
Storage
-20C
Provider Type Product Number
- No reagents -