HPA050257

SPEN antibody from Atlas Antibodies
KIAA0929, MINT, RBM15C, SHARP

Antibody data

Product number
HPA050257
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA050257, RRID:AB_2681065
Product name
Anti-SPEN
Provider product page
Atlas Antibodies - HPA050257
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GEAVENQEVQSKKPIPSKPQLKQLQVLDDQGPERE
DVRKNYCSLRDETPERKSGQEKSHSVNTEEKIGID
IDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKK
DVDEYERRSLVHEVGKPPQDVTDDSPPSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -