PAB20849

SPEN antibody from Abnova Corporation
KIAA0929, MINT, RBM15C, SHARP

Antibody data

Product number
PAB20849
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20849, RRID:AB_10965226
Product name
SPEN polyclonal antibody
Provider product page
Abnova Corporation - PAB20849
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SPEN.
Antigen sequence
NRERAYEHSAYGHHERGTGGFDRTRHYDQDYYRDP
RERTLQHGLYYASRSRSPNRFDAHDPRYEPRAREQ
FTLPSVVHRDIYRDDITREVRGRRPERNYQHSRSR
SPHSSQSRNQSPQRLASQASRPTRSPSGSGSRSRS
SSSDSI
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -