Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- GTX14070 - Provider product page

- Provider
- GeneTex
- Proper citation
- GeneTex Cat#GTX14070, RRID:AB_370657
- Product name
- RGS6 antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding to amino acids 231-265 of Human RGS6.
- Reactivity
- Rat
- Host
- Chicken/Avian
- Vial size
- 25µl, 100µl
- Storage
- Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data