ABIN149397

antibody from antibodies-online

Targeting: RGS6

Western blot

Antibody data

Submit

Validation data

Product number: ABIN149397 - Provider product page
Provider: antibodies-online
Product name: anti-Regulator of G-Protein Signaling 6 (RGS6) antibody
Antibody type: Polyclonal
Antigen: Synthetic peptide: KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding to amino acids 231-265 of Human RGS6.
Reactivity: Human
Host: Chicken/Avian
Vial size: 50 µg
Concentration: 1 mg/ml
Storage: Store at 4 C. Aliquot and store at -20 C long-term.

RGS6 protein structure - ABIN149397 shown in red.