Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN266113 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Regulator of G-Protein Signaling 6 (RGS6) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding toamino acids 231-265 of Human RGS6.
- Reactivity
- Human, Mouse, Rat
- Host
- Chicken/Avian
- Vial size
- 50 µg
- Concentration
- 1 mg/ml
- Storage
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting