HPA020066

PPM1K antibody from Atlas Antibodies
BDP, DKFZp761G058, hPTMP, PP2Ckappa, PP2Cm
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020066
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020066, RRID:AB_1855628
Product name
Anti-PPM1K
Provider product page
Atlas Antibodies - HPA020066
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PETKRIKLHHADDSFLVLTTDGINFMVNSQEICDF
VNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFG
AWGKYKNSEINFSFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -