ABIN631029

antibody from antibodies-online

Targeting: PPM1K BDP, DKFZp761G058, hPTMP, PP2Ckappa, PP2Cm

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631029 - Provider product page
Provider: antibodies-online
Product name: anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K) antibody
Antibody type: Polyclonal
Antigen: PPM1 K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

PPM1K protein structure - ABIN631029 shown in red.