HPA020862

PPM1K antibody from Sigma-Aldrich
BDP, DKFZp761G058, hPTMP, PP2Ckappa, PP2Cm
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020862, RRID:AB_1855629
Product name
Anti-PPM1K antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020862
Antibody type
Polyclonal
Antigen
Protein phosphatase 1K, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAA
DFCHTHMEKCIMDLLPKEKNLETLLTLAFLEIDKA
FSSHAR
Storage
-20C
Provider Type Product Number
- No reagents -